NGRN Antibody - N-terminal region : Biotin

NGRN Antibody - N-terminal region : Biotin
SKU
AVIARP58748_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NGRN may be involved in neuronal differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NGRN

Key Reference: Ishigaki,S., (2000) Biochem. Biophys. Res. Commun. 279 (2), 526-533

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neugrin

Protein Size: 291

Purification: Affinity Purified
More Information
SKU AVIARP58748_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58748_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51335
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×