NGRN Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NGRN may be involved in neuronal differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NGRN

Key Reference: Ishigaki,S., (2000) Biochem. Biophys. Res. Commun. 279 (2), 526-533

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neugrin

Protein Size: 291

Purification: Affinity Purified

• SKU: AVIARP58748_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58748_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51335
• Host: Rabbit
• Conjugate: Conjugated, HRP