NHLRC2 Antibody - N-terminal region : Biotin

NHLRC2 Antibody - N-terminal region : Biotin
SKU
AVIARP55889_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NHLRC2

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NHL repeat-containing protein 2

Protein Size: 726

Purification: Affinity Purified
More Information
SKU AVIARP55889_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55889_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 374354
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×