NHLRC2 Antibody - N-terminal region : HRP

NHLRC2 Antibody - N-terminal region : HRP
SKU
AVIARP55889_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NHLRC2

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NHL repeat-containing protein 2

Protein Size: 726

Purification: Affinity Purified
More Information
SKU AVIARP55889_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55889_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 374354
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×