NKIRAS1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1

Key Reference: Adams,M.D., (er) Ann. Rheum. Dis. (2008) In press

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1

Protein Size: 192

Purification: Affinity Purified

• SKU: AVIARP55370_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55370_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 28512
• Host: Rabbit