NKIRAS1 Antibody - N-terminal region : HRP

NKIRAS1 Antibody - N-terminal region : HRP
SKU
AVIARP55370_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1

Key Reference: Adams,M.D., (er) Ann. Rheum. Dis. (2008) In press

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1

Protein Size: 192

Purification: Affinity Purified
More Information
SKU AVIARP55370_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55370_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 28512
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×