NKX3-2 Antibody - middle region : HRP

NKX3-2 Antibody - middle region : HRP
SKU
AVIARP58064_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NKX3-2 is a member of the NK family of homeobox-containing proteins. It may play a role in skeletal development.This gene encodes a member of the NK family of homeobox-containing proteins. The encoded protein may play a role in skeletal development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1111 BC111966.1 1-1111 1112-2241 AC006445.11 110916-112045

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NKX3-2

Key Reference: Rodrigo,I., (2004) Mol. Cell. Biol. 24 (7), 2757-2766

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: GAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Nkx-3.2

Protein Size: 333

Purification: Affinity Purified
More Information
SKU AVIARP58064_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58064_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 579
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×