NLRP1 Antibody : HRP

NLRP1 Antibody : HRP
SKU
AVIARP54479_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence AAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHL

Molecular Weight: 166 kDa

Peptide Sequence: Synthetic peptide located within the following region: AAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NACHT, LRR and PYD domains-containing protein 1

Protein Size: 1473

Purification: Affinity Purified
More Information
SKU AVIARP54479_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54479_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Human Gene ID 22861
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×