NLRP2 Antibody - C-terminal region : HRP

NLRP2 Antibody - C-terminal region : HRP
SKU
AVIARP57052_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NALP proteins, such as NALP2, are characterized by an N-terminal pyrin (MIM 608107) domain (PYD) and are involved in the activation of caspase-1 (CASP1; MIM 147678) by Toll-like receptors (see TLR4; MIM 603030). They may also be involved in protein complexes that activate proinflammatory caspases (Tschopp et al., 2003 [PubMed 12563287]).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NLRP2

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NACHT, LRR and PYD domains-containing protein 2

Protein Size: 1062

Purification: Affinity Purified
More Information
SKU AVIARP57052_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57052_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55655
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×