NMBR Antibody - N-terminal region : Biotin

NMBR Antibody - N-terminal region : Biotin
SKU
AVIARP58501_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-100 AL589674.9 90178-90277 c 101-1308 M73482.1 99-1306 1309-1354 AL589674.9 77086-77131 c This locus represents an antisense transcript of the survivin locus. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 AF086186.1 11-280 271-869 AC087645.19 118062-118660 870-1098 L26245.1 740-968 1099-1286 BM839824.1 1-188 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NMBR

Key Reference: Matusiak,D., Am. J. Physiol. Gastrointest. Liver Physiol. 288 (4), G718-G728

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuromedin-B receptor

Protein Size: 390

Purification: Affinity Purified
More Information
SKU AVIARP58501_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58501_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4829
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×