NMRAL1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein is binding , oxidoreductase activity ,and transcription repressor activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NMRAL1

Key Reference: Zhao,Y., (2008) J. Biol. Chem. 283 (16), 11004-11013

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NmrA-like family domain-containing protein 1

Protein Size: 299

Purification: Affinity Purified

• SKU: AVIARP58502_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58502_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57407
• Host: Rabbit