NOB1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: NOB1 may play a role in mRNA degradation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NOB1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RNA-binding protein NOB1

Protein Size: 412

Purification: Affinity Purified

• SKU: AVIARP54976_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54976_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 28987
• Host: Rabbit