NOLA3 Antibody - middle region : Biotin

NOLA3 Antibody - middle region : Biotin
SKU
AVIARP57279_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOLA3

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: H/ACA ribonucleoprotein complex subunit 3

Protein Size: 64

Purification: Affinity Purified

Subunit: 3
More Information
SKU AVIARP57279_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57279_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55505
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×