NPHP1 Antibody - middle region : FITC

NPHP1 Antibody - middle region : FITC
SKU
AVIARP56084_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.This gene encodes a protein with src homology domain 3 (SH3) patterns. This protein interacts with Crk-associated substrate, and it appears to function in the control of cell division, as well as in cell-cell and cell-matrix adhesion signaling, likely as part of a multifunctional complex localized in actin- and microtubule-based structures. Mutations in this gene cause familial juvenile nephronophthisis type 1, a kidney disorder involving both tubules and glomeruli. Defects in this gene are also associated with Senior-Loken syndrome type 1, also referred to as juvenile nephronophthisis with Leber amaurosis, which is characterized by kidney and eye disease, and with Joubert syndrome type 4, which is characterized by cerebellar ataxia, oculomotor apraxia, psychomotor delay and neonatal breathing abnormalities, sometimes including retinal dystrophy and renal disease. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPHP1

Key Reference: Eley,L., (2008) Biochem. Biophys. Res. Commun. 371 (4), 877-882

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nephrocystin-1

Protein Size: 733

Purification: Affinity Purified
More Information
SKU AVIARP56084_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56084_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4867
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×