NPTX2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPTX2

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neuronal pentraxin-2

Protein Size: 431

Purification: Affinity Purified

• SKU: AVIARP56365_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56365_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4885
• Host: Rabbit