NRBP1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NRBP1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: nuclear receptor-binding protein

Protein Size: 543

Purification: Affinity Purified

• SKU: AVIARP54950_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54950_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29959
• Host: Rabbit