NRBP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: NRBP1 may play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRBP1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear receptor-binding protein

Protein Size: 535

Purification: Affinity Purified

• SKU: AVIARP54949_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54949_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29959
• Host: Rabbit