NRBP1 Antibody - N-terminal region : HRP

NRBP1 Antibody - N-terminal region : HRP
SKU
AVIARP54949_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NRBP1 may play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRBP1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nuclear receptor-binding protein

Protein Size: 535

Purification: Affinity Purified
More Information
SKU AVIARP54949_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54949_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29959
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×