NRDC Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRD1

Key Reference: Hiraoka,Y., (2008) Biochem. Biophys. Res. Commun. 370 (1), 154-158

Molecular Weight: 132kDa

Peptide Sequence: Synthetic peptide located within the following region: GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: nardilysin

Protein Size: 1151

Purification: Affinity Purified

• SKU: AVIARP58755_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58755_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4898
• Host: Rabbit
• Conjugate: Conjugated, Biotin