NRDC Antibody - middle region : FITC

NRDC Antibody - middle region : FITC
SKU
AVIARP58755_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRD1

Key Reference: Hiraoka,Y., (2008) Biochem. Biophys. Res. Commun. 370 (1), 154-158

Molecular Weight: 132kDa

Peptide Sequence: Synthetic peptide located within the following region: GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: nardilysin

Protein Size: 1151

Purification: Affinity Purified
More Information
SKU AVIARP58755_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58755_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4898
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×