NRL Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neural retina-specific leucine zipper protein

Protein Size: 237

Purification: Affinity Purified

• SKU: AVIARP58167_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58167_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4901
• Host: Rabbit