NSMCE3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDNL2

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: non-structural maintenance of chromosomes element 3 homolog

Protein Size: 304

Purification: Affinity Purified

• SKU: AVIARP57727_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57727_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 56160
• Host: Rabbit