NT5C1B Antibody - N-terminal region : Biotin

NT5C1B Antibody - N-terminal region : Biotin
SKU
AVIARP58646_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1B

Key Reference: Wang,A. Biochim. Biophys. Acta 1521 (1-3), 12-18 (2001)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic 5'-nucleotidase 1B

Protein Size: 550

Purification: Affinity Purified
More Information
SKU AVIARP58646_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58646_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 93034
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×