NT5DC1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of NT5DC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC1

Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-nucleotidase domain-containing protein 1

Protein Size: 455

Purification: Affinity Purified

• SKU: AVIARP55511_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55511_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221294
• Host: Rabbit