Ntf3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Ntf3 is a neuronal survival protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Ntf3

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neurotrophin-3

Protein Size: 258

Purification: Affinity Purified

• SKU: AVIARP56367_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56367_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81737
• Host: Rabbit