NUBP1 Antibody - middle region : Biotin

NUBP1 Antibody - middle region : Biotin
SKU
AVIARP56356_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUBP1

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: SGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic Fe-S cluster assembly factor NUBP1

Protein Size: 320

Purification: Affinity Purified
More Information
SKU AVIARP56356_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56356_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4682
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×