NUBP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUBP1

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic Fe-S cluster assembly factor NUBP1

Protein Size: 320

Purification: Affinity Purified

• SKU: AVIARP56355_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56355_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4682
• Host: Rabbit