NUP43 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BG567254.1 2-11 11-24 CB989591.1 28-41 25-47 AK074311.1 1-23 48-1751 AF514997.1 1-1704 1752-2581 BC047539.1 2681-3510 2582-2745 BC046637.1 2350-2513 2746-2818 BG527619.1 33-105 c 2819-3862 BC046637.1 2587-3630

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP43

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoporin Nup43

Protein Size: 380

Purification: Affinity Purified

• SKU: AVIARP55922_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55922_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 348995
• Host: Rabbit