NXT1 Antibody - N-terminal region : Biotin

NXT1 Antibody - N-terminal region : Biotin
SKU
AVIARP54919_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXT1

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NTF2-related export protein 1

Protein Size: 140

Purification: Affinity Purified
More Information
SKU AVIARP54919_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54919_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29107
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×