OGDHL Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of OGDHL remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDHL

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 2-oxoglutarate dehydrogenase-like, mitochondrial

Protein Size: 1010

Purification: Affinity Purified

• SKU: AVIARP57175_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57175_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55753
• Host: Rabbit