OLFML1 Antibody - middle region : HRP

OLFML1 Antibody - middle region : HRP
SKU
AVIARP55874_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OLFML1

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Olfactomedin-like protein 1

Protein Size: 402

Purification: Affinity Purified
More Information
SKU AVIARP55874_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55874_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283298
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×