OLFML1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLFML1

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactomedin-like protein 1

Protein Size: 402

Purification: Affinity Purified

• SKU: AVIARP55873_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55873_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 283298
• Host: Rabbit