OMP Antibody - middle region : FITC

OMP Antibody - middle region : FITC
SKU
AVIARP56668_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse kno

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMP

Key Reference: Behrens,M., (2003) J. Neurochem. 86 (5), 1289-1296

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified
More Information
SKU AVIARP56668_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56668_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Goat (Caprine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4975
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×