ONECUT2 Antibody - middle region : HRP

ONECUT2 Antibody - middle region : HRP
SKU
AVIARP57926_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2

Key Reference: Chamberlain,P.P., (2007) J. Biol. Chem. 282 (38), 28117-28125

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: One cut domain family member 2

Protein Size: 504

Purification: Affinity Purified
More Information
SKU AVIARP57926_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57926_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9480
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×