OPA1 Antibody - N-terminal region : FITC

OPA1 Antibody - N-terminal region : FITC
SKU
AVIARP57715_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: SPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial dynamin-like 120 kDa protein EMBL ADP90061.1

Protein Size: 924

Purification: Affinity Purified
More Information
SKU AVIARP57715_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57715_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4976
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×