OR10X1 Antibody - middle region : FITC

OR10X1 Antibody - middle region : FITC
SKU
AVIARP58506_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OR10X1

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory receptor 10X1

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP58506_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58506_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 128367
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×