OSGEP Antibody - middle region : HRP

OSGEP Antibody - middle region : HRP
SKU
AVIARP57038_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OSGEP

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP57038_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57038_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55644
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×