OSGEP Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGEP

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP

Protein Size: 335

Purification: Affinity Purified

• SKU: AVIARP57037_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57037_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55644
• Host: Rabbit