OSGIN1 Antibody - N-terminal region : Biotin

OSGIN1 Antibody - N-terminal region : Biotin
SKU
AVIARP55853_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGIN1

Key Reference: Ong,C.K., (2007) Oncogene 26 (8), 1155-1165

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Oxidative stress-induced growth inhibitor 1

Protein Size: 560

Purification: Affinity Purified
More Information
SKU AVIARP55853_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55853_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29948
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×