OSGIN1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGIN1

Key Reference: Ong,C.K., (2007) Oncogene 26 (8), 1155-1165

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Oxidative stress-induced growth inhibitor 1

Protein Size: 560

Purification: Affinity Purified

• SKU: AVIARP55853_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55853_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29948
• Host: Rabbit