OSGIN1 Antibody - N-terminal region : HRP

OSGIN1 Antibody - N-terminal region : HRP
SKU
AVIARP55853_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGIN1

Key Reference: Ong,C.K., (2007) Oncogene 26 (8), 1155-1165

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Oxidative stress-induced growth inhibitor 1

Protein Size: 560

Purification: Affinity Purified
More Information
SKU AVIARP55853_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55853_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29948
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×