Pa2g4 Antibody - C-terminal region : FITC

Pa2g4 Antibody - C-terminal region : FITC
SKU
AVIARP57879_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pa2g4 may play a role in a ERBB3-regulated signal transduction pathway. It seems be involved in growth regulation. It acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). It inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. It may be involved in ribosome assembly. It mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). It together with PTBP1 is required for the translation initiation on the foot-and-mouth disease virus (FMDV) IRES.

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proliferation-associated protein 2G4

Protein Size: 394

Purification: Affinity Purified
More Information
SKU AVIARP57879_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57879_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18813
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×