PAIP2 Antibody - N-terminal region : FITC

PAIP2 Antibody - N-terminal region : FITC
SKU
AVIARP56241_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PAIP2 acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. It displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization.

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Polyadenylate-binding protein-interacting protein 2

Protein Size: 127

Purification: Affinity Purified
More Information
SKU AVIARP56241_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56241_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51247
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×