PALM Antibody - N-terminal region : Biotin

PALM Antibody - N-terminal region : Biotin
SKU
AVIARP56270_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PALM

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paralemmin-1

Protein Size: 343

Purification: Affinity Purified
More Information
SKU AVIARP56270_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56270_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5064
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×