Specificity: Human CD36
Antibody Modification: Unconjugated
Presentation: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36 (NP_001120916.1). ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ
Gene: CD36
Description: CD36 antibody LS-B15329 is an unconjugated rabbit polyclonal antibody to CD36 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Usage: The predicted MW is 32kDa/46kDa/48kDa/53kDa, while the observed MW by Western blot was 85kDa/100kDa.
Synonyms: CD36, Cluster determinant 36, FAT, Fatty acid translocase, Glycoprotein IIIb, gp4, GPIIIB, GPIV, PAS-4 protein, PAS IV, PASIV, Platelet collagen receptor, Platelet glycoprotein IV, SCARB3, Thrombospondin receptor, BDPLT10, CD36 antigen, CHDS7, gp3B, PAS-4, Platelet glycoprotein 4
Recommended Storage: Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
English
Deutsch
