PBLD Antibody - N-terminal region : Biotin

PBLD Antibody - N-terminal region : Biotin
SKU
AVIARP56239_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of the PBLD protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PBLD

Key Reference: van (2005) Nat. Genet. 37 (5), 514-519

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phenazine biosynthesis-like domain-containing protein

Protein Size: 280

Purification: Affinity Purified
More Information
SKU AVIARP56239_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56239_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64081
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×