PBLD Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of the PBLD protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PBLD

Key Reference: van (2005) Nat. Genet. 37 (5), 514-519

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phenazine biosynthesis-like domain-containing protein

Protein Size: 280

Purification: Affinity Purified

• SKU: AVIARP56239_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56239_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64081
• Host: Rabbit