PCCB Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCCB

Key Reference: Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Propionyl-CoA carboxylase beta chain, mitochondrial

Protein Size: 539

Purification: Affinity Purified

• SKU: AVIARP56116_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56116_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5096
• Host: Rabbit