PCOLCE Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCOLCE

Key Reference: Grgurevic,L., (2007) Int Orthop 31 (6), 743-751

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Procollagen C-endopeptidase enhancer 1

Protein Size: 449

Purification: Affinity Purified

• SKU: AVIARP56378_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56378_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5118
• Host: Rabbit