Pde2a Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The activation of Pde2a induces decreased cAMP accumulation; It is involved in nitric oxide mediated signaling in cardiac fibroblasts.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cGMP-dependent 3',5'-cyclic phosphodiesterase

Protein Size: 935

Purification: Affinity Purified

• SKU: AVIARP56379_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56379_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81743
• Host: Rabbit